Handyman Services Of Wichita

Handyman Services Of Wichita Contact information, map and directions, contact form, opening hours, services, ratings, photos, videos and announcements from Handyman Services Of Wichita, Wichita, KS.

https://handymanserviceswichitakansas.com/
Best commercial residential handyman maintenance professionals in Wichita KS
CALL (316) 448-3974 HANDYMAN
Location: Wichita KS HANDYMAN SERVICES OF WICHITA
(316) 448-3974 https://handymanserviceswichitakansas.com/

WICHITA HOUSEHOLD SERVICES
(316) 448-3558 http://wichitahouseholdservices.com/

AONE HANDYMAN WICHITA
(316) 448-3974 http://ahandymanwi

chita.com

WICHITA BEST HANDYMAN AND REMODELING
(316) 448-3974 http://wichitabesthandyman.com

REMODELING CONTRACTORS OF WICHITA
(316) 448-3974 http://remodelingcontractorsofwichita.com

Best Commercial Cleaning Services and Cost in Wichita KS | Handyman Services Of WichitaMore information is at: https://h...
07/09/2022

Best Commercial Cleaning Services and Cost in Wichita KS | Handyman Services Of Wichita
More information is at: https://handymanserviceswichitakansas.com/commercial-cleaning-services-near-me/

Commercial Cleaning Services Near Wichita KS: Are you looking for the Best Commercial Cleaning Services near Wichita KS? Handyman Services Of Wichita, We will dispose of all your post-construction materials and meticulously clean your home, office or facility after or during your construction/renovation. Cost? Free estimates! Send us a message or call us today. Best Commercial Cleaning Services around Wichita KS. We serve Wichita KSand other areas. Get a Free Quote Now!

BEST COMMERCIAL CLEANING SERVICES IN WICHITA KS

WICHITA COMMERCIAL CLEANING

Commercial Cleaning At Handyman Services Of Wichita
Commercial Cleaning Services near Wichita KS: After expending so much effort to build or remodel your home or office, it only makes sense to move into a space that shines. Wichita KS’s Little Elves Post-Construction Clean-up Crew includes trained experts who will make this difficult job absolutely turnkey. Each team is specifically hand-selected to meet your needs, and provides the following services:
● Vacuuming and dusting of all surfaces and upholstery, from ceilings and walls to floors
● Cleaning the tops of doors, door k***s, hardware, moldings
● Complete disinfection of kitchens and bathrooms
● Gentle cleaning of floors, baseboards, cabinets, counters, light fixtures, appliances
● All glass, stone, and metal surfaces gently cleaned
● Dust removal from blinds, ceiling pipes/fans, air ducts, vents, light fixtures
● Window cleaning, including sills, window frames, and glass
● Desk and cabinet cleaning (for offices)
● HEPA filter vacuums and air machines provided for maximum dust removal

Construction Cleaning

Commercial Cleaning Services near Wichita KS: If your home, property or office has recently been through either a big or small construction project, and is now cluttered by debris, call the construction cleanup experts at Handyman Services Of Wichita.

We can also offer cleaning services during construction. We applied a three stage cleaning process to ensure a thorough and complete job. Our three stage cleaning process includes: Extensive cleaning, detail cleaning and final/touch-up cleaning.
We will dispose of all your post-construction materials and meticulously clean your home, office or facility after or during your construction/renovation.
Contractors and homeowners throughout Wichita KSrely on Handyman Services Of Wichita to remove dirt, dust and debris that construction crews leave behind. We provide the professional cleaners to get the work done so that you can get back to business or your new home.
Our post construction clean-up services include but are not limited to the following:
● Floor Maintenance and more.
● Heavy Material Removal
● Detailing and deep cleaning
● Post-construction and post-remodeling
● Extensive dust removal during cleaning process
● Washing all surfaces
● Stain Removal & Floor Scrubbing
● High dust removal from ceiling pipes, duct work, vents, light fixtures, etc.
● Full sanitizing of kitchens and bathrooms to make them ready for your use.
● Window and glass cleaning including scraping and etching removal
● Scrub floors and tiles, polish stainless steel, wipe walls and more.
● Floor cleaning, Floor Waxing and Floor Buffing
● Cleaning Window Sills and Window Frames
● Cleaning inside and outside of all home/office furniture
● Dusting and Vacuuming of all surfaces including trim work and home/office furniture.

Dumpster Availability

Commercial Cleaning Services near Wichita KS:
● Dusting: remove dust from walls, moisten a soft towel with water and wrap it around the bottom of a broom. Secure with tape if necessary.
● Window washing: removal of stickers, adhesive, paint, and drywall over-spray from glass (use a razor blade scraper).
● Polish: all chrome, porcelain, Formica, and horizontal surfaces.
● Floor Cleaning. Start 1st with the floor this allows the dust to settle before you clean countertops and fixtures. If you sweep last, everything you just cleaned will be covered with dust before you leave.
Important Tips to remember:
● Dust gets everywhere after construction.
● A maid service is not equipped for proper deep cleaning.

COST

Commercial Cleaning Services near Wichita KS: The average cost of cleaning after construction is $550.

How much does it cost to clean a commercial site?

Whether it is a new build or a remodel, construction is an exciting endeavor. Unfortunately, it is difficult to sit back and enjoy your finished project immediately after completion. That is because construction produces a lot of dust, debris, and other dirt.
You can clean this yourself, but most people choose to hire a post construction cleaning service to take care of the job. The average residential post construction clean costs around $550 to complete. This price varies, however, depending on the size of the project and the scale of the clean.

Benefits of hiring construction cleaning professionals

Commercial Cleaning Services near Wichita KS: Construction and remodeling are messy jobs. At a minimum, they produce a lot of dust, which can get everywhere within a home or business. This dust settles in places where it may not always be obvious or part of everyday cleaning.
In addition, construction may leave behind debris or workers may track mud 1 or other substances through rooms. Many materials and new surfaces, such as windows and cabinets, may have stickers or residue that need to be washed off.
All of these things are technically cleanable by the home or business owner, but it takes time. You may not have the proper filters or cleaning materials necessary or realize all the places and areas that debris and dust can settle. Often, there are also leftover materials like nails, glass, or wires that can be hazardous if handled improperly. Professionals know how to dispose of these safely, so you do not have to.
Professionals can thoroughly clean a space from top to bottom and leave it in good condition. They can also remove germs, pest infestations, and other substances that you may not have been aware of.

Labor

Commercial Cleaning Services near Wichita KS: Labor costs vary tremendously depending on the scope of the project, how much you want cleaned, and the state of the area to be cleaned. The average cost per hour for this service is $25 per worker, with many projects taking a minimum of 8 hours to complete and a minimum of 2 workers. Some areas are also charged an additional fee per area or per square foot, such as an extra fluff clean, which consists of a final walk-through and staging of the home. Specialty cleans range from $0.06 to $0.50 a square foot. This is in addition to the base hourly fee. A home remodel, which requires 2 workers and 8 hours and includes windows both inside and out, costs around $550.

FREQUENTLY ASKED QUESTIONS

What Should I do to Prepare for My Cleaning Service?

Getting prepared for your cleaning service is easy and simple. Don’t bother to go out of your way to move furniture out of the way for us. Just complete your regular daily tasks and we will take care of the rest. From light daily duties like vacuuming and bathroom cleanups to top to bottom building disinfection, we’ll pick up where you left off making your space sparkle.

Do You Provide Supplies?

Everything outlined in your estimate and agreed upon price and terms will be provided by us. This includes; all supplies, labor, advanced cleaning equipment, tools, and chemical solutions. Your health and safety are important to us, we use only top of the line chemicals and are certified in the correct mixing processes.

What Kinds of Products Do You Use?

Our products include a mixture of neutral PH and alkaline cleaners that are used for degreasing and disinfection. In the bathroom, we use an acid-based porcelain bowl cleaner to reclaim toilets and fixtures, making them look clean and ready to use. For a full list of our products and their specifications, get in touch with our commercial janitorial consultants today.

What Kind of Equipment Do You Use?

We use reliable new cleaning equipment, tools, and machines that are well cared for and maintained on a regular schedule. Each of our staff is thoroughly trained and certified in the safe and proper operation of all the tools, machines, chemicals, and work vehicles we use to get the job done right. Here’s a peek at some of our equipment inventory. If you’d like to see more, give us a call or send an email to receive more information.

Do You Provide Free Estimates?

Our reputation has been built on providing free estimates. Our licensed consultants would like the opportunity to come to you, so we can see your commercial facility for ourselves. Once we are confident we understand your objectives and the challenges you are facing, we’ll formulate a detailed plan that produces superior results without costing you a fortune.

How Do I Book Your Services?

Book our services when you need them. We respond to calls 24 hours a day, 7 days a week so we can better serve clients who require emergency custodial assistance. Give us a call or send us an email to set up an appointment at your convenience. We look forward to getting to know your goals, so we can help you bring them to life.
Want to know more about how we can save you time and money while delivering the best commercial janitorial services in the city? Call us now.

CALL FOR US:
● Commercial Cleaning Services Near Wichita KS
● Construction Clean Up Duties
● Free Post Construction Cleaning Calculator
● Post Construction Cleaning Training
● Post Construction Cleaning Scope Of Work
● Pre-Construction Cleaning Wichita KS
● Construction Clean Up License
● Post Construction Cleaning Tips
● New Construction House Cleaning
● Post Construction Cleaning Calculator App
● Post Construction Cleaning Checklist
● Post Construction Cleaning Scope Of Work
● Post Construction Cleaning Proposal
● Construction Clean Up Duties
● Post Construction Cleaning Tips
● Commercial Post Construction Cleaning Wichita KS

BEST COMMERCIAL CLEANING SERVICES IN WICHITA KS
HANDYMAN SERVICES OF WICHITA
REQUEST MORE INFORMATION. CONTACT US NOW!
CONTACT US:
Handyman Services Of Wichita
Best commercial residential handyman maintenance professionals in Wichita KS
(316) 448-3974 HANDYMAN
(316) 500-7551 CLEANING
(316) 448-5733 JUNK REMOVAL
Location: Wichita KS
Timing: 7 AM – 11 PM
Websites:
handymanserviceswichitakansas.com
bestcleaningserviceswichita.com/
junkremovalhaulerwichita.org/
Service area:
55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS
Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS
Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS
Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS
Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS
Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS
Winfield, KS | Yoder, KS
ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven







Are you searching for Best Commercial Cleaning Services in Wichita KS? Handyman Services Of Wichita is providing Best Commercial Cleaning Services. Call us!

Best Bathroom Remodeling Services and Cost in Wichita KS|Handyman Services Of WichitaMore information is at: https://han...
07/09/2022

Best Bathroom Remodeling Services and Cost in Wichita KS|Handyman Services Of Wichita
More information is at: https://handymanserviceswichitakansas.com/bathroom-remodeling-services-near-me/

Bathroom Remodeling Services Near Wichita KS: Are you Searching for Best Bathroom Remodeling Services near Wichita KS? Handyman Services Of Wichita ,we'll provide you with a comprehensive bathroom remodeling service estimate. Let us help you find the right building materials and styles for your budget and personal design tastes. Cost? Free estimates! Send us a message or call us today. Best Bathroom Remodeling Service around Wichita KS. We serve Wichita KSand other areas. Get a Free Quote Now!

BEST BATHROOM REMODELING SERVICES IN WICHITA KS
WICHITA BATHROOM REMODELING

Choose Handyman Services Of Wichita To Create The Bathroom Of Your Dreams

Bathroom Remodeling Services Near Wichita KS: When it comes to bathroom design and remodeling in Wichita KS, you need a bathroom remodeling company who can marry beautiful design to functional usage, in a limited amount of space.
Whether you’re looking for a complete remodel of all the bathrooms in your home, or you’re simply looking to replace the toilet and sink countertops in just one of them, our experienced team of design and construction experts are at your disposal. At Handyman Services Of Wichita, our philosophy is that unity of idea and design is the first requisite to creating stunning results. Call us today for an upfront, no hidden fees estimate from Wichita KS’s top-quality bathroom remodeling team.
Bathroom remodeling
Bathroom Remodeling Services Near Wichita KS: Whether creating your own personal spa area or just updating for resale Gotham Builders of Wichita KSoffers full service bathroom remodeling. We are able to create a space where you will begin and end your day with life's worries washed away.
From replacing your counters or floors to bathroom makeovers complete with , our professional remodeling contractors complete every job with the highest sense of integrity and professionalism. We can't wait to help you design and build your Wichita KSdream bathroom.
Trip Free Senior Friendly Bathrooms
We can convert your existing bathroom into a senior friendly bathroom. We can provide amenities such as senior friendly showers, walk-in tubs, grab bars and much more. Learn about our senior friendly bathrooms.
Our Bathroom Remodeling Services Include:
● Custom bathroom remodeling
● Safety showers and tubs
● Granite counters
● Custom sinks and vanities
● Bathroom floor tiling
Modern Bathroom Must-haves
Perhaps you know you’re due for a bathroom upgrade, but you aren’t sure where to start. After all, there’s just so many remodeling options available, and that’s not even getting into the different styles and materials.
At Handyman Services Of Wichita, we believe in starting with the fundamentals and working our way from there. When it comes to giving your bathroom a clean, modern look, here are some essential upgrades you can make to improve your bathroom’s style and functionality.
● Double Sinks
Whether you’re remodeling the master bathroom or the kid’s bathroom, double sinks have almost become a necessity.
Not only do double sinks give a greater amount of counter space, they also allow multiple bathroom users to get ready at the same time. This means less fighting and a more peaceful morning routine.
● Sauna or Steam Shower
These functions can be added to any shower in order to create a relaxing getaway within your own home.
While both of these options rely on heat and provide great health benefits like improved blood circulation and muscle relaxation, saunas provide a dry heat (which encourages detoxification through sweating) while steam showers provide a wet heat (which can help with respiratory issues and cleaning out your sinuses).
● Upgraded Toilet
Why open and close the lid to the toilet or take the time to clean it when you can purchase a toilet that will do those things for you?
Hidden tank (or hidden cistern) toilets are an especially popular modern upgrade. Not only do they have a sleek look, but these toilets also help you save precious space an especially valuable commodity in Wichita KSand make efficient use of water.
● Heated Floors
Gone are the days of getting out of a hot shower only to step on a cold floor. In-floor radiant heat creates a true spa-like feeling that simply can’t be beat.
While radiant heating is all about providing optimal comfort on a cold Wichita KSwinter’s day, it also boasts low maintenance costs and greater energy efficiency.
● Built-in Television
Catch up on the news first thing in the morning or unwind at night with your favorite TV show and a bubble bath. You can even disguise a TV as a mirror for a functional design element.
Whatever Your Bathroom…
Visit our midtown Wichita KSbathroom showroom to see ingenious ways to make small feel bigger…and designs that take luxury to a whole new level…all from leading national and international companies.
Small Bathroom Remodeling
Bathroom Remodeling Services Near Wichita KS:A small bathroom in Wichita KSis often a fact of life, luckily we have over 15 years of experience in optimizing limited space with clever small bathroom renovation ideas. Designed by the experts at Handyman Services Of Wichita, small is no longer a limitation as our contractors will incorporate your wants with your needs, all while adhering to your personal style.
There is truly no better solution than Handyman Services Of Wichita for small bath renovations.
Luxury Bathroom Design
We create luxury bathroom designs based on your vision and personal style.
Your living space can be injected with comfort and class with an upscale bathroom remodeling. Designed by our team of refined experts, your new luxurious bathroom can become the starting point for your elegant home, or be the final touch that completes your dream home. If you live in any of the five boroughs Wichita KS, call for your free consultation and start designing an exclusive bathroom for your home today!
Visit our Handyman Services Of Wichita bathroom showroom to see luxury designs by leading Wichita KSand bath renovators.
Design Goals
Bathroom Remodeling Services Near Wichita KS:
At Handyman Services Of Wichita bathroom remodeling consultant works with you through the four stages of design.
● Measurement. We accurately and repeatedly measure everything in your bathroom.
● Layout. We conceptualize and design everything, including where your new cabinets, water technology and backsplashes will go. We consider all your needs, including possible tub-to-shower conversions, walk-in tubs and easy-access showers. With unlimited revisions, we’ll rework every aspect until you are fully satisfied.
● Selections. We help you match everything, so the tile, tub, vanities, water technology and everything else all complement each other beautifully. Everything else? We carry decorative door k***s and other fancy bathroom accessories.
● Budget. We work with you to establish a budget and then create a unique design to that budget. Since we are both the supplier and contractor, we know the exact price of each component. This maximizes your options and eliminates unnecessary costs. Whether it’s a “gut” renovation or an intimate bathroom design, whatever the size of your budget, your bathroom should look like you spent more.
Supply
Bathroom Remodeling Services Near Wichita KS: Everything you need for your bathroom renovation is in our showroom. Whether you want traditional to modern…a luxury bathroom or just an update…we have the selection of bathroom products and accessories. We source globally; your choices are international. Whether it’s something you imagine or something you saw in a magazine or on the web, we can give you that bathroom.
What We Carry:
● Cabinets: A vast array from numerous manufacturers, including top national and international brands such as Ultra Craft, Bauformat and Showplace as well as local shops. We can source any cabinet in any style, material and finish, including all the hardware that goes with it.
● Countertops: Natural stones, including granite. Also quartz, stainless steel, wood, glass, concrete and other specialty surfaces. So many wonderful bathroom countertops!
● Vanities: All the latest brands and models.
All available to you for any contracting job we do for you!
Installation
Bathroom Remodeling Services Near Wichita KS: No other contractor comes close to our degree of quality, service, project management, problem solving and warranties. By hiring Handyman Services Of Wichita, you’re hiring a contractor who has gone through rigorous and extensive training, an expert contractor capable of handling any remodeling project, a committed contractor who will work until the bathroom of your dreams becomes a reality…or, in fact, the renovation exceeds your expectations. To see photos of some of our latest projects, check out our bathroom and kitchen portfolio.
Give us a call today and Handyman Services Of Wichita, we’ll provide you with a comprehensive bathroom remodeling service estimate. Let us help you find the right building materials and styles for your budget and personal design tastes.

TIPS
Bathroom Remodeling Services Near Wichita KS: Bathrooms are the number one place that homeowners love to remodel, even more than kitchens. The space is smaller, making the job a bit easier. Plus, this reduced space means reduced cost: less flooring and paint, fewer cabinets and countertop. Follow these tips to make your bathroom remodel more attractive while keeping the process smooth, efficient, and cost-effective.
● Recess For Extra Room
When space is extremely tight, built-ins such as recessed soap dishes, medicine cabinets, and even toilet roll holders pry out as much available room as possible from tiny bathrooms. You can even flatten the ceiling light by converting your ceiling light into a recessed light.
● Address Bathroom Ventilation
All bathrooms need some type of ventilation, by code, either in the form of a properly sized window or a bathroom exhaust fan. For bathroom fans, look at both their exhaust capacity (or how many cubic feet of air per minute they can move) in conjunction with their noise levels.
● Add Plants for Living Color
Plants in the bathroom should not be an afterthought. Plants bring much-needed color into sterile bathrooms. Consider adding a floating shelf expressly for the purpose of giving your trailing plants a cozy home.
● Pick the Right Flooring
Solid wood floors, while they do infuse bathrooms with great character, are not the best type of flooring material for bathrooms, from a practical standpoint. Instead, pick flooring that is hardly enough to stand up against the rigors of daily bathroom use. Bathroom flooring favorites include ceramic and porcelain tile, luxury vinyl plank, vinyl tiles, and sheet vinyl flooring.
● Adjust Room Size With Color
To make a small bathroom look bigger, make sure that your color palette stays in the white-or-light color spectrum. Dark colors make the room feel smaller, claustrophobic. Use white or light-colored fixtures (i.e., toilet and bathtub). Always think twice about painting your bathroom ceiling any color but white or off-white, as this tends to shrink the room down even more.
● Bathroom Lighting Matters
In a room where people need to visually inspect their hair and faces, lighting is usually very dim and concentrated only in one spot—namely, from a ceiling fixture. At the very least, consider adding lighting around the bathroom mirror in the form of sconces. But blinding light is not always wanted. A very simple device that can add mood to your bathroom is a dimmer switch. The dimmer switch is perfect for late-night relaxing baths.
● Add Freestanding Pieces
If space permits, many home decorators recommend having one freestanding piece such as a decorative chair or cupboard as a design element. To compensate for that space, you can recess other practical elements such as clothes hampers or simply move the hamper to another room. This decorative piece, of course, can also serve a practical use as a place to store towels, soaps, or other small items.
● Add More Opportunities to Hang Items
Hooks are the easiest way to add surface area to a bathroom without actually adding a real countertop surface area. Hooks can be used for everything from clothes to bathrobes to towels. Place hooks on the back of the door, on the side of cabinets, or on unused sections of walls.
● Include More Mirrors in the Bathroom
Most people think of mirrors in bathrooms only for the purpose of checking makeup or primping hair. But it’s also important to think of mirrors in bathrooms as design elements that expand the room visually and add light to the room. Many homeowners like to add a second mirror in addition to the primary mirror located above the bathroom sink.
● Protect the Lower Section of the Wall
Beadboard has two great functions. First, where appropriate, it creates an antique look and it is so easy to install. Secondly, beadboard performs the very valuable function of protecting the lower section of the walls from the inevitable splashes of water that occur in bathrooms from the tub or shower. A good coat of oil-based paint ensures that the beadboard will be practically impervious to moisture. If beadboard does not stylistically fit your room, consider adding tile wainscot on the bottom 40 to 48 inches of the wall. Tile, too, serves the same purpose of protecting the walls against moisture, and it had an infinite range of style possibilities.

COST
How Much Does It Cost To Remodel A Bathroom?
Bathroom Remodeling Services Near Wichita KS: The bathroom is the most trafficked room in the home and as such, more and more homeowners in Wichita KSare renovating and creating their dream bathrooms. Unlike other rooms, there are many features in any Wichita KSbathroom, ranging from toilets, sinks and showers to backsplashes, floors and faucets. Clearly, there’s a lot to consider with any Wichita KSbathroom remodel.
Wichita KSBathroom Remodeling Cost
The average cost of a bathroom remodel in Wichita KSis $21,000. Nonetheless, we have seen bathroom renovation costs in Wichita KSrange from as low as $8,000 for a simple guest bathroom update to as high as $45,000 for a master bathroom remodel in Wichita KS.
Materials
Bathroom Remodeling Services Near Wichita KS: Material costs can vary wildly depending on the quality and style of the fixtures you choose. To educate yourself on pricing, here are the major expenses you can expect:
● Wall & Floor Tiles: These can range from $3 per square foot for basic ceramic subway or penny tiles to around $15 per square for glass or red clay tiles and over $35 per square foot for top-of-the-line stone or marble tiles. (Money-saving tip: Limit tiling costs by painting direct water-exposed areas with moisture-resistant, high-gloss paint instead.)
● Sink & Vanity: You can buy sink bowls solo or with their own storage vanities. Sink bowls alone run $50-$5,000 and vanities about $250 for a basic option, up to $3,000+ for semi-custom pieces.
● Sink & Shower Fixtures: Basic faucets and showerheads are $40 to $350+. Statement versions (think handheld showerheads and adjustable water settings) can run up to $1,000.
● Bathtub: Standard tubs sell for $600 to $3,000+, depending on the size and finish. Those with bonus features, like hydro jets, cost extra and will add more in plumbing and, possibly, electrical labor costs. (Money-saving tip: Instead of investing in a new tub, have your existing one re-glazed for about $400.)
● Shower Enclosure: A glass door for shower $350 to $2,000 costs more than a basic curtain, to be sure, but a door won’t require replacing.
● Toilet: Think $150 for a basic tank-and-bowl option to $1,000+ for fancier versions with tanks mounted behind the wall or special features like heated seats, hands-free flushing and seat covers that open and close automatically.
● Medicine Cabinet: These range from $50 for a basic wall-mounted unit that hangs on the surface of the wall to $500+ for space-saving, recessed versions.
● Accessories: Hooks, towel bars, toilet paper holder and the like can be found for $10 to $100+ apiece.
● Lighting: Plan on $25 each for basic flush mounts and up to $500 or more for higher-end pendants and fixtures.
● Extras: If you’re dreaming of radiant floor heating or his-and-her vanities, those will add to your tally. Just weigh your wishes against your budget to decide where to save and where to splurge.
Bathroom Labor Costs In Wichita KS
Bathroom Remodeling Services Near Wichita KS: Beyond materials, a chunk of your bathroom renovation budget will go towards labor. Given the significance of the bathroom, most Wichita KShomeowners hire local bathroom contractors to get the job done quickly and efficiently. Sadly, you have to pay for such services.
The labor cost largely depends on the job and contractor. For example, the average labor cost to install a steam shower ranges between $486 and $788. On the other hand, to install new bathroom countertops, many pros charge per hour. Some contractors charge as little as $50/hour and others charge as much as $150/hour. Furthermore, plumbing is a whole new category. Most Wichita KSplumbers have fixed labor prices ranging from $300 to $1,500 per installation.
Bathroom Renovation Cost Factors
Besides materials and labor, there are other price factors to consider. While you can control some, you can’t control others. Nevertheless, knowing all beforehand will not only help you negotiate, but also help you budget for your upcoming Wichita KSbathroom renovation.
● Bathroom Size: Some bathrooms are 40sf and others are 100sf. More often than not, labor and materials depend on the square footage. For example, red oak floors cost as little as $2/sf, but maple wood floors cost as much as $14/sf. Therefore, for just new floors, your bathroom material cost could range from $80 to $1,400.
● Bathroom Customizations: Pre-fabricated cabinets cost a lot less than custom cabinets. The same can be said for multiple bathroom materials. If you need to limit the cost to redo your bathroom, keep customizations to a minimum.
● Bathroom Trends: Home remodeling trends change every day. Believe it or not, some homeowners actually installed carpet in their bathrooms back in the day. Today, potential buyers would run if they saw that. Moreover, trends vary by city. Therefore, before you remodel your bathroom, ask local realtors what’s hot right now. Even better, go to open houses in your neighborhood and see what they added to their bathrooms. If you plan on selling your home in the next 10 years, it will surely pay to know what hot bathroom aspects are trending.
● Bathroom Budget: With any home remodeling project, set a budget and stick to it. If you don’t, you will 100% go over and regret your decision later on. Also, expect surprises, especially if you’re opening walls. As such, include a contingency section in your overall bathroom budget.
● Bathroom Project: Certain Wichita KSbathroom projects cost a lot less than others. For example, installing counters in Wichita KScosts $2,977, while the average cabinet installation cost in Wichita KSis $4,767. Clearly, your overall bathroom remodel cost will depend on the project at hand.

FREQUENTLY ASKED QUESTIONS

How long does a bathroom remodeling typically take from start to finish?

At the risk of sounding elusive, we really must say that it depends. The scope of the bathroom remodeling dictates how long the project will take. For example, if you are relocating your fixtures and reconfiguring the room, the actual construction will obviously take a little bit longer. But, it is important to remember that moving fixtures will generally require building department permits, which will also add to the project time.

What do I need to do to prepare for my bathroom renovation?

You can start by getting a good idea for the type of look and style you want. If you don’t know yet, look at some magazines, websites, or watch some home remodeling shows to get some design ideas. Then, contact us for a Free Design Consultation with a Remodeling Consultant. You will be instructed by your Remodeling Consultant as to what exact steps you need to take. But, generally speaking, before construction begins, you’ll want to clear out the area being worked on of all your personal belongings that can be removed. Although we cover the areas surrounding our work area, you’ll want to protect your furniture from dust with plastic and/or sheets.

What is the typical workflow for a bathroom renovation?

● Create design
● Sub flooring
● Countertop installation
● Select materials
● Floor tile installation
● Medicine cabinet installation
● Order materials
● Electric wiring
● Light fixtures installation
● Deliver materials
● Wall preparation
● Accessories installation
● Demolition
● Wall tile installation
● Painting
● Plumbing
● Plumbing fixture installation
● Touch up and cleaning

Will a Handyman Services Of Wichita designer help me choose all of the materials?

Since we have all the materials you need at our showroom, yes, a Handyman Services Of Wichita Remodeling consultant will help you choose everything you need.

Can I buy those products from Handyman Services Of Wichita?

Yes. That is a major component of what makes us a full service firm. The fact that we are able to design everything for you, help you choose the materials, and sell them to you, makes it very convenient for clients. But, it is also important to note that we don’t require you to purchase the materials from us. You may shop at other locations.

Do I need to have design ideas before I start the renovation process?

Absolutely not; but it helps if you do. Your Free Design Consultation is meant to help generate ideas or work through the ones you already have.

What features should I plan to invest the most in for my new bathroom?

Depending on your style and taste, the floor and wall tiles can be the most expensive. Other possibly considerable expenses are the fixtures and shower system.

What type of return on investment can I expect from remodeling my bathroom if I sell my home?

Bathrooms typically get the best return on investment in a remodeled home, the national average return on investment for bathroom remodeling was between 93.2% and 102.2% depending upon whether the budget is upscale or moderate. In large metropolitan areas like Wichita KS, the return ranged from 116% to 136.3%. So, many people actually make substantial money when investing in a bathroom remodeling project.

How much lighting will my bathroom need?

Strictly speaking, bathrooms need enough lighting to illuminate the entire room. But that short answer isn’t the end of the story for this. While you need total illumination in the bathroom, your main light source doesn’t need to provide it.

Your main light source in the bathroom could actually be quite soft, so long as you bolster its effect with some bright secondary lights. Consider small overhead or recessed lights for that purpose. The strong illumination additional lighting can provide over task areas like the vanity and sink will help you achieve focus, while the dimmer glow of other light(s) would give your bathroom a very relaxed feeling. The combination is perfect for this haven of self-care.

Why is replacing a tile shower so costly?

This is one of the most expensive changes you can make in your bathroom. The reason is that you’re not only adding new tile but also securing it beforehand. You’ll need to treat the surrounding area to guarantee a tight water seal and proper drainage. Consider the initial expense a precaution to avoid a larger one if your tile shower functions improperly. That is the costliest bathroom repair, so you have to prevent it.

What type of tile should I use for my bathroom floor and shower?

Your choice depends on personal preference. There are numerous materials and styles that will suit your needs. Selecting the best one requires you to identify what’s most important. Does the room receive a lot of light? How much foot traffic will the bathroom receive?

CALL FOR US:
● Bathroom Remodeling Services Near Wichita KS
● Bathroom Remodeling Ideas
● Bathroom Ideas
● Bathroom Remodeling Contractors
● Bathroom Renovation Cost
● Bathroom Design
● Bathroom Remodel Ideas On A Budget
● Bathroom Ideas Photo Gallery
● Bathroom Remodel Ideas Near Wichita KS
● Bathroom Construction Cost
● 5x7 Bathroom Remodel Cost
● Bathroom Remodel Examples With Cost
● Bathroom Renovation Cost
● Bathroom Cost Per Square Foot
● Master Bathroom Remodel Cost
● Bathroom Renovation Cost
● 5x8 Bathroom Remodel Cost Near Wichita KS

BEST BATHROOM REMODELING SERVICES IN WICHITA KS
HANDYMAN SERVICES OF WICHITA
REQUEST MORE INFORMATION. CONTACT US NOW!
CONTACT US:
Handyman Services Of Wichita
Best commercial residential handyman maintenance professionals in Wichita KS
(316) 448-3974 HANDYMAN
(316) 500-7551 CLEANING
(316) 448-5733 JUNK REMOVAL
Location: Wichita KS
Timing: 7 AM – 11 PM
Websites:
handymanserviceswichitakansas.com
bestcleaningserviceswichita.com/
junkremovalhaulerwichita.org/
Service area:
55 Cities within 30 miles of Wichita, KS: Andale, KS | Andover, KS | Argonia, KS | Augusta, KS | Belle Plaine, KS | Bentley, KS | Benton, KS | Buhler, KS | Burns, KS | Burrton, KS | Cheney, KS | Clearwater, KS
Colwich, KS | Conway Springs, KS | Danville, KS | Derby, KS | Douglass, KS | Elbing, KS | Garden Plain, KS
Goddard, KS | Greenwich, KS | Halstead, KS | Harper, KS | Haven, KS | Haysville, KS | Hesston, KS | Hutchinson, KS | Kechi, KS | Maize, KS | Mayfield, KS | Mcconnell AFB, KS | Milan, KS | Milton, KS
Mount Hope, KS | Mulvane, KS | Murdock, KS | Newton, KS | North Newton, KS | Norwich, KS | Peck, KS
Potwin, KS | Pretty Prairie, KS | Rock, KS | Rose Hill, KS | Sedgwick, KS | South Hutchinson, KS
Towanda, KS | Udall, KS | Valley Center, KS | Viola, KS | Walton, KS | Wellington, KS | Whitewater, KS
Winfield, KS | Yoder, KS
ZIP CODES: 67001 – Andale | 67016 – Bentley | 67017 – Benton | 67020 – Burrton | 67025 – Cheney | 67026 – Clearwater | 67030 – Colwich | 67031 – Conway Springs | 67037 – Derby | 67039 – Douglass | 67050 – Garden Plain | 67052 – Goddard | 67055 – Greenwich | 67060 – Haysville | 67067 – Kechi | 67101 – Maize | 67106 – Milton | 67108 – Mt Hope | 67110 – Mulvane | 67118 – Norwich | 67120 – Peck | 67133 – Rose Hill | 67135 – Sedgwick | 67147 – Valley Center | 67149 – Viola | 672xx – Wichita | 67204 – Park City or Wichita | 67219 – Park City or Wichita | 67220 – Bel Aire or Wichita | 67221 – McConnell AFB | 67226 – Bel Aire or Wichita | 67543 – Haven







Are you searching for Best Bathroom Remodeling Services in Wichita KS? Handyman Services Of Wichita is providing Best Bathroom Remodeling Services. Call us!

Address

Wichita, KS
67211

Opening Hours

Monday 7am - 9pm
Tuesday 7am - 9pm
Wednesday 7am - 9pm
Thursday 7am - 9pm
Friday 7am - 9pm
Saturday 7am - 9pm
Sunday 7am - 9pm

Alerts

Be the first to know and let us send you an email when Handyman Services Of Wichita posts news and promotions. Your email address will not be used for any other purpose, and you can unsubscribe at any time.

Contact The Business

Send a message to Handyman Services Of Wichita:

Share